标签： His

GH1, GH, GHN, GH-N, hGH-N,Pituitary GH, GH 1, 

GH is a member of the prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the GH locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five GHs, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the GH locus. Mutations in or deletions of the gene lead to GH deficiency and short stature.

GH Chicken Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 191 amino acids with an additional Ala at its N-terminus and having a molecular mass of 22255 Dalton.
GH Chicken recombinant is purified by proprietary chromatographic techniques.

Protein quantitation was carried out by two independent methods:
1. UV spectroscopy at 280 nm using the absorbency value of 0.75 as the extinction coefficient for a 0.1% solution at pH 8.0 This value is calculated by the PC GENE computer analysis program of protein sequences .
2. Analysis by RP-HPLC, using a calibrated solution of GH as a Reference Standard.

ProSpec’s products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.

GH1, GH, GHN, GH-N, hGH-N,Pituitary GH, GH 1.

GH is a member of the prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the GH locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five GHs, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the GH locus. Mutations in or deletions of the gene lead to GH deficiency and short stature.

GH Denis Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 190 amino acids and having a molecular mass of 21810 Dalton.
GH is purified by proprietary chromatographic techniques.

It is recommended to reconstitute the lyophilized GH Denis in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Lyophilized GH Denis although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GH Denis should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein .
Please prevent freeze-thaw cycles.

AQPITDGQRLFSIAVSRVQHLHLLAQRLFSDFESSLQTEEQPQLNKIFLQ

DFCNCDYIISPIDKHETQRSSVLKLLSISYRLVESWEFPSRSLSGGSAPR

NQISPKLSELKTGIHLLIRANEDGAEIFPDRSALQLAPYGNYYQSLGTDE

SLRRTYELLACFKKDMHKVETYLTVAKCRLSPEANCTL

HGH-20K was lyophilized from a concentrated solution with 0.0045mM NaHCO3 previously adjusted to pH 10.

It is recommended to reconstitute the lyophilized Growth Hormone Pituitary in 0.4% NaHCO3 adjusted to pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

2. Analysis by RP-HPLC, using a calibrated solution of GH-20K as a Reference Standard.

The GH was lyophilized from 1.13mg/ml in 1xPBS.

The activity was determined by the dose dependent stimulation of the proliferation of rat lymphoma line Nb2-11 cells , the ED₅₀ is 0.1ng/ml.

It is recommended to reconstitute the lyophilized Growth Hormone Mahi Mahi in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

GH1, GH, GHN, GH-N, hGH-N, Pituitary GH, GH-1.

GH is a member of the prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the GH locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five GHs, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the GH locus. Mutations in or deletions of the gene lead to GH deficiency and short stature.

Growth Hormone Mouse Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 190 amino acids and having a molecular mass of 22 kDa. Mouse GH is purified by proprietary chromatographic techniques.

Mouse Growth Hormone Recombinant contains 20mM Tris-HCl, pH8.0, 150mM NaCl buffer, pH-8.

It is recommended to reconstitute the lyophilized Growth Hormone Murine in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Lyophilized GH mouse although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GH mouse should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein .
Please prevent freeze-thaw cycles.

Greater than 95.0% as determined by -PAGE.

Recombinant Mouse GH is fully biologically active when compared to standard Human GH which is 3 units/mg.

ProSpec’s products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.

Somatotropin Rainbow Trout Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 188 amino acids with an additional Ala at the N-terminus and having a molecular mass of 21, 535 Dalton.
The Rainbow Trout Growth-Hormone Recombinant is purified by proprietary chromatographic techniques.

The protein was lyophilized from a concentrated solution with 0.5% NaHCO3. Adjusted to pH-8.

It is recommended to reconstitute the lyophilized Growth-Hormone Rainbow Trout in 0.4% NaHCO3 or water adjusted to pH 8-9, not less than 100µg/ml and not more than 3mg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.

Lyophilized Growth-Hormone Rainbow Trout although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein .
Please prevent freeze-thaw cycles.

Greater than 95.0% as determined by:
Analysis by SEC-HPLC.
Analysis by -PAGE.

AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNIVSPVD
KHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLIT
GSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCR
KSLEANCTL.

Somatotropin Rainbow Trout Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.

GH1, GH, GHN, GH-N, hGH-N,Pituitary GH, GH-1.

GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the gGH locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five GHs, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the GH locus. Mutations in or deletions of the gene lead to GH deficiency and short stature.

GH Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 190 amino acids and having a molecular mass of 21810 Dalton.
GH is purified by proprietary chromatographic techniques.

It is recommended to reconstitute the lyophilized GH Rat in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Lyophilized GH Rat although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GH Rat should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein .
Please prevent freeze-thaw cycles.

AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPL

SFCNIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSS

TISNSLTIGNPNLITEKLVDLKMGISVLIKGCLDGQPNMDDNDSL

PLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL

2. Analysis by RP-HPLC, using a calibrated solution of GH-22K-placental as a Reference Standard.

HGF Human Recombinant produced in HEK cells is a glycosylated disulfide-linked heterodimer, containing 697 a.a. having a total molecular weight of 80kDa.

The HGF is purified by proprietary chromatographic techniques.

The HGF was lyophilized from a solution containing 10mM Sodium phosphate, 150mM NaCl, 0.01% Tween 80 and 100mM L-Arginine, pH 6.5.

It is recommended to reconstitute the lyophilized Hepatocyte Growth Factor in sterile 18MΩ-cm H₂O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Greater than 90.0% as determined by -PAGE.

The activity was measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells . The EC₅₀ for this effect is typically 20-40ng/ml.