标签： HEK

HGH-20K was lyophilized from a concentrated solution with 0.0045mM NaHCO3 previously adjusted to pH 10.

It is recommended to reconstitute the lyophilized Growth Hormone Pituitary in 0.4% NaHCO3 adjusted to pH 10, not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

2. Analysis by RP-HPLC, using a calibrated solution of GH-20K as a Reference Standard.

The GH was lyophilized from 1.13mg/ml in 1xPBS.

The activity was determined by the dose dependent stimulation of the proliferation of rat lymphoma line Nb2-11 cells , the ED₅₀ is 0.1ng/ml.

It is recommended to reconstitute the lyophilized Growth Hormone Mahi Mahi in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

GH1, GH, GHN, GH-N, hGH-N, Pituitary GH, GH-1.

GH is a member of the prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the GH locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five GHs, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the GH locus. Mutations in or deletions of the gene lead to GH deficiency and short stature.

Growth Hormone Mouse Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 190 amino acids and having a molecular mass of 22 kDa. Mouse GH is purified by proprietary chromatographic techniques.

Mouse Growth Hormone Recombinant contains 20mM Tris-HCl, pH8.0, 150mM NaCl buffer, pH-8.

It is recommended to reconstitute the lyophilized Growth Hormone Murine in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Lyophilized GH mouse although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GH mouse should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein .
Please prevent freeze-thaw cycles.

Greater than 95.0% as determined by -PAGE.

Recombinant Mouse GH is fully biologically active when compared to standard Human GH which is 3 units/mg.

ProSpec’s products are furnished for LABORATORY RESEARCH USE ONLY.They may not be used as drugs,agricultural or pesticidal products, food additives or household chemicals.

Somatotropin Rainbow Trout Recombinant produced in E.Coli is a single, non-glycosylated polypeptide chain containing 188 amino acids with an additional Ala at the N-terminus and having a molecular mass of 21, 535 Dalton.
The Rainbow Trout Growth-Hormone Recombinant is purified by proprietary chromatographic techniques.

The protein was lyophilized from a concentrated solution with 0.5% NaHCO3. Adjusted to pH-8.

It is recommended to reconstitute the lyophilized Growth-Hormone Rainbow Trout in 0.4% NaHCO3 or water adjusted to pH 8-9, not less than 100µg/ml and not more than 3mg/ml, which can then be further diluted to other aqueous solutions, preferably in a presence of a carrier protein such as BSA or similar.

Lyophilized Growth-Hormone Rainbow Trout although stable at room temperature for at least two weeks, should be stored desiccated below -18°C. Upon reconstitution and filter sterilization GH can be stored at 4°C, pH 9 for up to 4 weeks. For long term storage and more diluted solutions it is recommended to add a carrier protein .
Please prevent freeze-thaw cycles.

Greater than 95.0% as determined by:
Analysis by SEC-HPLC.
Analysis by -PAGE.

AIENQRLFNIAVSRVQHLHLLAQKMFNDFDGTLLPDERRQLNKIFLLDFCNIVSPVD
KHETQKSSVLKLLHISFRLIESWEYPSQTLIISNSLMVRNANQISEKLSDLKVGINLLIT
GSQDGVLSLDDNDSQQLPPYGNYYQNLGGDGNVRRNYELLACFKKDMHKVETYLTVAKCR
KSLEANCTL.

Somatotropin Rainbow Trout Recombinant is biologically active in PDF-P1 3B9 cells stable transfected with rabbit GH receptors, though its activity is about 10 fold lower than that of human GH.

GH1, GH, GHN, GH-N, hGH-N,Pituitary GH, GH-1.

GH is a member of the somatotropin/prolactin family of hormones which play an important role in growth control. The gene, along with four other related genes, is located at the gGH locus on chromosome 17 where they are interspersed in the same transcriptional orientation; an arrangement which is thought to have evolved by a series of gene duplications. The five genes share a remarkably high degree of sequence identity. Alternative splicing generates additional isoforms of each of the five GHs, leading to further diversity and potential for specialization. This particular family member is expressed in the pituitary but not in placental tissue as is the case for the other four genes in the GH locus. Mutations in or deletions of the gene lead to GH deficiency and short stature.

GH Rat Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain containing 190 amino acids and having a molecular mass of 21810 Dalton.
GH is purified by proprietary chromatographic techniques.

It is recommended to reconstitute the lyophilized GH Rat in sterile 18MΩ-cm H2O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Lyophilized GH Rat although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution GH Rat should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein .
Please prevent freeze-thaw cycles.

AQRLFNNAVIRVQHLHQLAAKMINDFEEGLMPEERRQLSKIFPL

SFCNIETPTGKDETQKSSMLKLLRISFRLIESWEFPSQTLSS

TISNSLTIGNPNLITEKLVDLKMGISVLIKGCLDGQPNMDDNDSL

PLPFEDFYLTVGETSLRESFRLLACFKKDMHKVETYLRVANCRRSLDSNCTL

2. Analysis by RP-HPLC, using a calibrated solution of GH-22K-placental as a Reference Standard.

HGF Human Recombinant produced in HEK cells is a glycosylated disulfide-linked heterodimer, containing 697 a.a. having a total molecular weight of 80kDa.

The HGF is purified by proprietary chromatographic techniques.

The HGF was lyophilized from a solution containing 10mM Sodium phosphate, 150mM NaCl, 0.01% Tween 80 and 100mM L-Arginine, pH 6.5.

It is recommended to reconstitute the lyophilized Hepatocyte Growth Factor in sterile 18MΩ-cm H₂O not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Greater than 90.0% as determined by -PAGE.

The activity was measured in a cell proliferation assay using 4MBr-5 rhesus monkey epithelial cells . The EC₅₀ for this effect is typically 20-40ng/ml.

Lyophilized from a 0.2µm filtered solution in 20mM PB, pH 8.0, 1M NaCl.

2.Title:Transforming Growth Factor-Alpha: A Major Human Serum Factor that Promotes Human Keratinocyte Migration.
Publication:Journal of Investigative Dermatology 126, 2096–2105. doi:10.1038/sj.jid.5700350; published online 11 May 2006.
Link:http://www.nature.com/jid/journal/v126/n9/full/5700350a.html

FGF stands for fibroblast growth factor that have proteins encoded inside them. The FGF family possess broad mitogenetic activities and are involved in a lot of processes in the body. Some of the biological processes that they are included in are embryonic development, cell growth, tumor growth and tissue repair. FGF-7 is often also commonly referred to as keratinocyte growth factor or KGF and studies have focused on the link between the protein and certain tumor growth.

Structure
Studies have found that the crystal structure of FGF7 is comparatively similar to that of FGF10. For instance, FGF7 does interact with D2, linker as well as D3 of the receptor. Similar to other FGFs much of interaction to do with D2 is confined to conserved residues as well as the residue Arg 251 in the linker domain and the hydrophobic surface of D2. That said there are notable differences and some models predict that FGF7 actually interacts with three loops in D3.

Mechanism
A member of the FGF family, this factor acts completely exclusively through a subset of FGF receptor isoforms. These are mainly expressed by epithelial cells. Indeed, studies suggest that the factor specifically acts on epithelial cells. This in turn causes increased proliferation differentiation and migrations of the aforementioned cells.

Interactions
FGF7 and FGF10 can interact with one of the FGF receptors that is expressed by the epithelial cells. As such, it could be the case that this interaction could cause a protective factor for these epithelial tissues. The protein has also been shown to interact with Perlecan. Also referred to as basement membrane specific heparan sulfate proteoglycan core protein, this is encoded by the HSPG2 gene. A large multi domain this cross-links and binds to various extracellular matrix components as well as self surface molecules. Since FGF7 binds specifically with the perlecan protein, research suggests that i should be considered a novel biological ligand for FGF-7. This could mean that interaction has an influence on both tissue remodeling and cancer growth.

Function
Studies have shown that FGF-7 expression is completely unregulated during minor or even chronic injury. This has lead researchers to believe that the protein is used to heal or repair epithelial cells. Furthermore, FGF-1 also triggers the formation of apical ectodermal ridge throughout the development of limbs in the body.
Recently, it has seemed to be the case that FGF-7 has been linked to skin injury repair, and has also been found to play some sort of role in breast cancer. As well as this, it is a vital regulator of HPC’s. It is vital because it can induce de novo activation of these HPCs.

Further research has shown that FGF6 is a niche signal that is required for the stimulation of adult liver progenitor cells and this can support liver regeneration. This research has lead to the suggestion that FGF7 could be a possibility therapeutic target for those suffering from liver diseases.
Studies like this are just one of the reasons why researchers continue to explore fgf-7, it’s functions and interactions.

PIGF, PGF, PLGF-1

Placental Growth Factor which is a member of the VEGF sub-family, is a growth factor active in angiogenesis, and endothelial cell growth, stimulating their proliferation and migration. PLGFmainly plays a role in trophoblast growth and differentiation and binds to receptor vegfr-1/flt1.

PLGF Human Recombinant produced in HEK293 cells is a single, glycosylated polypeptide chain containing 160 amino acids and having a molecular mass of 18.3kDa.
PLGF is fused to a 6 amino acid His-tag at C-terminus & purified by proprietary chromatographic techniques.

HEK293 cells.

Sterile filtered colorless solution.

PLGF protein contains 10% glycerol and Phosphate-Buffered Saline .

Store at 4°C if entire vial will be used within 2-4 weeks.
Store, frozen at -20°C for longer periods of time.
For long term storage it is recommended to add a carrier protein .
Avoid multiple freeze-thaw cycles.

Greater than 95.0% as determined by -PAGE.

DGSMAVPPQQ WALSAGNGSS EVEVVPFQEV WGRSYCRALE RLVDVVSEYP SEVEHMFSPS CVSLLRCTGC CGDENLHCVP VETANVTMQL LKIRSGDRPS YVELTFSQHV RCECRPLREK MKPERRRPKG RGKRRREKQR PTDCHLCGDA VPRRHHHHHH