ProSpec-HGF B Human

Scatter Factor, SF, Hepatopoietin, HPTA, HGF, HGFB, F-TCF, DFNB39, Hepatocyte growth factor, Hepatocyte growth factor beta chain.

Hepatocyte Growth Factor is a multifunctional growth factor which regulates both cell growth and cell motility. It exerts a strong mitogenic effect on hepatocytes and primary epithelial cells. HGF synergizes with Interleukin-3 and GM-CSF to stimulate colony formation of hematopoietic progenitor cells in vitro and may, therefore, also modulate hematopoiesis. HGF is secreted as a single inactive polypeptide which is cleaved by serine proteases into a 69kDa Alpha chain and 34kDa Beta chain. A disulfide bond linking the alpha and beta chains produces the active heterodimeric molecule.

HGF-B Human Recombinant produced in E.Coli is a single, non-glycosylated, Polypeptide chain containing 234 amino acids fragment having a molecular weight of 34kDa and fused with a 4.5kDa amino-terminal hexahistidine tag.
The HGF-B is purified by proprietary chromatographic techniques.

Escherichia Coli.

Sterile Filtered clear solution.

HGF-B protein is supplied in 25mM Na. Acetate, pH 4.8, 1mM EDTA and 50% glycerol.

Store at 4°C if entire vial will be used within 2-4 weeks.
Store, frozen at -20°C for longer periods of time.
Please avoid freeze thaw cycles.

Greater than 95.0% as determined by -PAGE.

VVNGIPTRTNIGWMVSLRYRNKHICGGSLIKESWVLTAR
QCFPSRDLKDYEAWLGIHDVHGRGDEKCKQVLNVSQLV
YGPEGSDLVLMKLARPAVLDDFVSTIDLPNYGCTIPEKTS
CSVYGWGYTGLINYDGLLRVAHLYIMGNEKCSQHHRGK
VTLNESEICAGAEKIGSGPCEGDYGGPLVCEQHKMRMV
LGVIVPGRGCAIPNRPGIFVRVAYYAKWIHKIILTYKVPQS.

ProSpec’s products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.