ProSpec-Leptin Pufferfish

OB Protein, Obesity Protein, OBS, Obesity factor.

A 16-kDa peptide hormone secreted from white adipocytes and implicated in the regulation of food intake and energy balance. Leptin provides the key afferent signal from fat cells in the feedback system that controls body fat stores.

Leptin Pufferfish Recombinant produced in E.Coli is a single, non-glycosylated, polypeptide chain having a molecular mass of 16 kDa.
Bioactive Leptin Pufferfish Recombinant was prepared according to the sequence published by Kurokawa et al. Peptides 26, 745-750 in two forms: monomer and covalent dimer. MS analysis revealed molecular masses of 15,291 and 30,585 Da, close to the theoretical values of 15,270 and 30,540 Da. CD spectra revealed high similarity to mammalian leptins. Other details of its preparation will be soon published by Yacobovitz et al , General and Comparative Endocrinology.
The Pufferfish Leptin is purified by proprietary chromatographic techniques.

Escherichia Coli.

Sterile Filtered White lyophilized powder.

The Pufferfish Leptin was lyophilized from a concentrated solution with 0.003mM NaHCO3.

It is recommended to reconstitute the lyophilized Pufferfish Leptin in sterile 0.4% NaHCO3 pH-9 not less than 100µg/ml, which can then be further diluted to other aqueous solutions.

Lyophilized Pufferfish Leptin although stable at room temperature for 3 weeks, should be stored desiccated below -18°C. Upon reconstitution Leptin should be stored at 4°C between 2-7 days and for future use below -18°C.
For long term storage it is recommended to add a carrier protein .
Please prevent freeze-thaw cycles.

Greater than 99.0% as determined by:
Analysis by SEC-HPLC.
Analysis by -PAGE.

ALPGALDAMDVEKMKSKVTWKAQGLVARIDKHFPDRGLRFDTDKVE

GSTSVVASLESYNNLISDRFGGVSQIKTEISSLAGYLNHWREGNCQE

QQPKVWPRRNIFNHTVSLEALMRVREFLKLLQKNVDLLERC

Protein quantitation was carried out by UV spectroscopy at 280 nm using the absorbency value of 1.28 as the extinction coefficient for a 0.1% solution. This value is calculated by the PC GENE computer analysis program of protein sequences .

Biological active as evidenced by inducing proliferation of BAF/3 cells stably transfected with the long form of human leptin receptor. The affinity of human leptin receptors is considerably lower campared to mammalian leptins.

ProSpec’s products are furnished for LABORATORY RESEARCH USE ONLY. The product may not be used as drugs, agricultural or pesticidal products, food additives or household chemicals.